PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.395320.1
Common NameCsa_2G352430, LOC101219997
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 401aa    MW: 45916 Da    PI: 6.6401
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.395320.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093193601455
                     HHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  14 eLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +  el +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Cucsa.395320.1 319 RWWELHNKWPYPSEAEKLALAESTGLDQKQINNWFINQRKRH 360
                     5556667889*****************************885 PP

2ELK35.91.6e-12280301122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++Ll+KYsgyL+sLkqE+s
  Cucsa.395320.1 280 ELKNHLLKKYSGYLSSLKQELS 301
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.3E-12130174IPR005540KNOX1
PfamPF037908.9E-16132173IPR005540KNOX1
SMARTSM012565.0E-25181232IPR005541KNOX2
PfamPF037911.1E-22188231IPR005541KNOX2
SMARTSM011882100190210IPR005539ELK domain
SMARTSM011881.0E-6280301IPR005539ELK domain
PROSITE profilePS5121311.243280300IPR005539ELK domain
PfamPF037898.0E-10280301IPR005539ELK domain
PROSITE profilePS5007113.102300363IPR001356Homeobox domain
SuperFamilySSF466898.98E-19301373IPR009057Homeodomain-like
SMARTSM003891.5E-13302367IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-26305365IPR009057Homeodomain-like
CDDcd000864.06E-12312364No hitNo description
PfamPF059205.6E-16320359IPR008422Homeobox KN domain
PROSITE patternPS000270338361IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MEDDEYKVHG DRCRGNFLYN SVPVLATNSS SPVGNFVIRS SYSSASSSNG NNHNHHHHHH  60
HMIMAAGHSN NYFPPSDQLQ LPVKVEPPTT TTTASSSQSH HIQLHDFHYH LMTEFQNNHI  120
NININNHNSD SIKAKILSHS LFSNILQAFL DCQNVGAPPE VAAKLTSVRE EFERQRSSMA  180
TAEGSSIDPE LDQFMEAYYG MLVKYREELR RPIQEAVDFM HRIESQLNTL CNGSFQILPS  240
GREGKSEGMG SSTEEEAEKG GEEEREIEED QIDPRAEERE LKNHLLKKYS GYLSSLKQEL  300
SKKKKKGKLP KDARQQLLRW WELHNKWPYP SEAEKLALAE STGLDQKQIN NWFINQRKRH  360
WKPSEDVQFM GMEGFYHPNA AAFYFDHGHF MADSHYRLGP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6864610.0LN686461.1 Cucumis melo genomic scaffold, unassembled_sequence33916.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649547.10.0PREDICTED: homeotic protein knotted-1
SwissprotO041351e-122KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A0A0LKV50.0A0A0A0LKV5_CUCSA; Uncharacterized protein
STRINGGLYMA14G10430.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45843246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-101KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]